DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Ccp84Ad

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:270 Identity:95/270 - (35%)
Similarity:119/270 - (44%) Gaps:101/270 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGKLLTVFSLLAIAASCRAGFAATYAGYH--PAYATY-QAPAAVYHAAPV-AQAAVYQQAAPVY 61
            ||.|.:.:|:|:|.|:   ||.......||  ||.||| |||.||.||.|| |:||         
  Fly     1 MAFKFIALFALIAAAS---AGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAA--------- 53

  Fly    62 AKTFVPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQ 126
                                                                             
  Fly    54 ----------------------------------------------------------------- 53

  Fly   127 VELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVV 191
            .|.:..|:|.::|.|.||::||.|||||.|||..|.|.||::||||:||||.||||.||||||||
  Fly    54 EEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVV 118

  Fly   192 QREPVVAARAVAAPVVSVSAP-----APVPVHISSAPVASLPAPI-YYPHQQVFAPQQIQQVAEQ 250
            .|||:|.|.|||..|.:|:||     ||...|.::..|....||: :|.     ||..::.||  
  Fly   119 NREPLVKAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYA-----APAVVKTVA-- 176

  Fly   251 QGEVVESPVA 260
                   |||
  Fly   177 -------PVA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 33/51 (65%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.