DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Ccp84Ae

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:257 Identity:94/257 - (36%)
Similarity:119/257 - (46%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VAAPVVKTLAAAPV-------VAAPVVKTVAAAPAVLKQVELES---SPRYDFSYGVHDSITGDI 149
            :||.:|..||...|       .||||....|..|.:.|.||||.   .|:|.:||.|.|:::||.
  Fly     1 MAAKIVIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDN 65

  Fly   150 KSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARA------VAAPVVS 208
            |..||.|||..|.|.||::||||||||||||||.||||||||:|||:.|..|      ||||:|.
  Fly    66 KGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLVK 130

  Fly   209 VSAPAPVPVHISSAPVA-SLPAPIYYPHQQVFAPQQIQQVAEQQGEVVESPVA-QQPELEPTPID 271
            .:..||:      |||| :.||||                      |..:||| ..|.::..|: 
  Fly   131 AAPVAPI------APVALAAPAPI----------------------VRSAPVAVAAPLIKSAPL- 166

  Fly   272 YNEGQQQQQEQQQQTYPQDQQFPPYSPAGQSSPAPDSDDSDVVEARSAPEASSTTTTAAPVT 333
                            .....|...:|...::|||        ..|:|..|:....||...|
  Fly   167 ----------------AVAAPFVRSAPLAVAAPAP--------VLRTAAYATPLRYTAPAYT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 33/51 (65%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.