DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:223 Identity:71/223 - (31%)
Similarity:96/223 - (43%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGKLLTVFSLLAIAASCRAG----FAATYAGYHPAYATYQA---PAAVYH---------AAPVA 49
            :.|||.:     :.|...:||    .:....||:.|.:...|   ||..||         |:..:
  Fly  1021 LGGKLAS-----STAYGIQAGNLGHGSGPSGGYYGAISLGHAKVSPALSYHGLLSHGSGLASGAS 1080

  Fly    50 QAAVYQQAAPVYAKTFVPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKT--LAAAPVVAAP 112
            ..|....:...|:.......|:....|        ..||:..||...|||..|  |.:|||....
  Fly  1081 SLAHLDSSLSGYSHGVGGIGPLGAGFY--------RYAPSVPALSSHAPVAATAYLKSAPVTQHA 1137

  Fly   113 VVKTVAAAPAVLKQVE-LESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRT 176
            |:|.|..     |.:| .::.|||.|.|.|:|..|||.|.|.|.|||..|.|.||:::.||..||
  Fly  1138 VLKVVPE-----KHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRT 1197

  Fly   177 VTYTADDINGFNAVV----QREPVVAAR 200
            |.|.||...||:|.|    .:..:||.|
  Fly  1198 VKYYADWETGFHAEVINSRDQGKIVAKR 1225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 26/51 (51%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.