DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:230 Identity:55/230 - (23%)
Similarity:90/230 - (39%) Gaps:62/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVHDSITGDIKSQVET 155
            :.|.|.:|   ||...|   .|...|::      :....:...:|.:.|      ...:.|:.||
  Fly    13 IGLAVGSP---TLEYGP---PPTSDTIS------QYHHQDEHGQYAYGY------MAPLYSKHET 59

  Fly   156 RDGGNVV-GSYSVLDADGFKRTVTYTADDINGFNAVV--------QREPVVA------------A 199
            |....|: |::|.:||:|..:||.|.| |..||:...        |..|.||            |
  Fly    60 RTVDGVIRGTFSHIDANGETQTVDYVA-DAEGFHVTSNLPNQQANQETPEVAALRTQHLEAHNQA 123

  Fly   200 RAVAAPVVSVSAPAPV--PVHISSAPVASLPAPIYYPHQQVFAPQQIQQ--VAEQQGEVVESP-- 258
            :...|...|| .|.||  ...:::|.||..         :.|..::::.  :||::..|:.:|  
  Fly   124 KLRLAGDYSV-GPQPVRDTPEVAAAKVAFF---------KRFEAEKLRNKLLAEKKVLVIPNPTP 178

  Fly   259 --VAQQP--ELEPTPID--YNEGQQQQQEQQQQTY 287
              |..||  ..:||...  ||...:.|.:...:.|
  Fly   179 IAVRSQPIYVYQPTTTGFVYNYHTKTQAQVPSRNY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 17/52 (33%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.