DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr72Ea

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:247 Identity:57/247 - (23%)
Similarity:79/247 - (31%) Gaps:69/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 FSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARA 201
            :|||..:.::.  |.:..|.| |...|.||..||.|..:||.|.||: .||:......|......
  Fly    49 YSYGYSEPLSS--KQETRTLD-GITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVPQ 109

  Fly   202 VAAPVVSVSAPAPVPVHIS-----SAPVASLPA---PIYYPHQQVFA-------PQQIQQVA--E 249
            .:......||..||..|:.     |..|...|.   ||..||.....       |.....|.  |
  Fly   110 ESLEFSPRSASHPVDHHVEHHAEVSHAVVQHPVGHHPIEVPHHHTVVESGRSAHPDGHHPVEHHE 174

  Fly   250 QQGEVVESPVAQQPELEP-----------------TPIDYNE----------------------- 274
            .:..|.:.||...|...|                 .|::::|                       
  Fly   175 HRVAVAQHPVGHHPVEVPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTV 239

  Fly   275 ---GQQQQQEQ----QQQTYPQDQQFPPYSPAGQSS-PAPDSDDSDVVEARS 318
               |:....|.    :...:|.....|..|..|.|. |.|.||.::|..|:|
  Fly   240 VESGRSAHPEVPHSIEHHEHPVSGSDPSGSHGGHSQLPHPVSDTAEVAAAKS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 18/49 (37%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453301
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.