DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr67B

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:176 Identity:42/176 - (23%)
Similarity:61/176 - (34%) Gaps:53/176 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 FSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARA 201
            |:||..|...|..:.:.||   |.|.|||..:...|......|.||. .||:....|        
  Fly    98 FAYGYRDWNQGKNEKRDET---GKVTGSYKYVQPHGRDFVANYYADK-TGFHVEDNR-------- 150

  Fly   202 VAAPVVSVSAPAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVAEQQ-----GEVVESPVAQ 261
                          |.|: ..|....||.:               .||::     ||:. :....
  Fly   151 --------------PAHL-KLPATKTPAVL---------------KAEEEHFKLWGELA-AAAGH 184

  Fly   262 QPELEPTPIDY-NEGQQQQQEQQQQTYPQDQQFPPYSPAGQSSPAP 306
            .|  :|...:| .||:.|..|.:.|.|..::  |||.|..:.:..|
  Fly   185 NP--DPYAAEYQQEGRYQPTEPEYQPYVHEE--PPYVPGPEETGEP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 16/49 (33%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.