DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr66D

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:304 Identity:78/304 - (25%)
Similarity:108/304 - (35%) Gaps:112/304 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGKLLTVFSLLA--IAASCRAGFAA----TYAGYHPAYATYQAPAAVYHAAPVAQAAVYQQAAPV 60
            :|:.:.:...:|  |.|..:.|:.|    .|..|.|..|.|:.||               |||| 
  Fly    66 SGQQIRIKDTVAEQIRAQQQQGYVAPSVRDYQQYQPQQAAYRPPA---------------QAAP- 114

  Fly    61 YAKTFVPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLK 125
                 .|...:...||..|:..:.......|:|.                              :
  Fly   115 -----QPPRRIQQSSYQAPSTSILGKGQHKLSLQ------------------------------Q 144

  Fly   126 QVELE----SSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDING 186
            |.|.|    .:..|.|.:.|.|....:.:::.|.|||..:.|||||:|:|||.|||.||||...|
  Fly   145 QNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEG 209

  Fly   187 FNAVVQREPVVAARAVAAPVVSVSAPAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVAEQQ 251
            |.|.|.|||.         .:.|..|.|.|                        |.|:.:....:
  Fly   210 FKAEVIREPT---------DIVVKIPTPPP------------------------PTQLLRAGGHK 241

  Fly   252 GEVVESPVAQQPELEPTPIDYNEG--QQQQQEQQQQTYPQDQQF 293
                    |||        :|:.|  :||.|.||||..||..|:
  Fly   242 --------AQQ--------EYSSGPSKQQYQHQQQQQQPQYHQY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 24/51 (47%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.