DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and CG13670

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:238 Identity:68/238 - (28%)
Similarity:98/238 - (41%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LALPVAAPVVKTLAA---------APVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVHDSIT 146
            |||.....::...||         .|||....:.||...    :.|:..:.|.|.|:|||.|..|
  Fly    54 LALIAGCGMIGACAAVGYSYARFEGPVVGPEHLVTVHDG----RTVDYVARPEYSFAYGVEDGKT 114

  Fly   147 GDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPV--VAARAVAAPVVSV 209
            ..::::.|||:|..|.|.|||:|.||..|.|.|||||.|||.|.|....|  :............
  Fly   115 RVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAEVITNGVKTLHGHGSDGDAGGG 179

  Fly   210 SAPAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVAEQQGEVVESPVAQQPELEPTPIDYNE 274
            |..:.|..|.:.|            |:   |.:..::..|::.|...:...|..|      ||:|
  Fly   180 SVDSQVRHHSAEA------------HK---AKEDDEEEDEREREHQGNGQYQVHE------DYDE 223

  Fly   275 GQQQQQEQQQ-----QTYPQDQQFPPYSPAGQSSPAPDSDDSD 312
            |:.:|.|:.:     |.|....: ..|..|...|...:|.|.|
  Fly   224 GKDEQAEEDEEGGGHQEYEGSSE-EGYVEADAHSQQEESSDED 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 27/51 (53%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 27/51 (53%)
Paf1 <215..265 CDD:281915 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.