DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:255 Identity:111/255 - (43%)
Similarity:145/255 - (56%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTVFSLL-AIAASCRAG-----FAATYAGYHPAY------ATYQAPAAVYHAAPVAQAA------ 52
            |||.::| ::|.|.:||     .||...|...||      |.|.||||  ::||:..||      
  Fly     4 LTVVAVLSSMALSAQAGLVGAPLAAAPLGAPLAYSAPLGPAPYFAPAA--YSAPLGYAAPLGYNA 66

  Fly    53 -VYQQAAPVYAKTFVPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLA--AAPVVAAPVV 114
             :....||:.:||:. ||| :...:|.|...|.|...||:|.|:||||....|  ||| ||||:.
  Fly    67 PLVAGPAPLVSKTYA-AAP-FAAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLAAP-VAAPLA 128

  Fly   115 KTVAAAPAVLKQVELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTY 179
            ..| |||...:.|  ::.|:|.|:|.|.|::|||.|:|.|||||..|.||||:::.||.:|.|:|
  Fly   129 APV-AAPIATEIV--DAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSY 190

  Fly   180 TADDINGFNAVVQRE------PV--VAARAVAAPVVSVSAPAPVPVHISSAPVASLPAPI 231
            .||.|||||||||::      ||  |.|:.|||||..|.|.||.||.     ..:|.|||
  Fly   191 YADSINGFNAVVQKDVPVAVAPVAPVLAKTVAAPVAPVVAAAPAPVF-----AKTLAAPI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 29/51 (57%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.