DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:185 Identity:83/185 - (44%)
Similarity:103/185 - (55%) Gaps:19/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VAPAP-LALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVHDSITGDI 149
            |.|.| |||| |.|....||.   ||||:|..||...      ..:.:|:|.|||.|||..|||:
  Fly    20 VVPGPGLALP-AYPSYPALAK---VAAPLVAKVAGPE------PYDPNPQYTFSYDVHDGSTGDV 74

  Fly   150 KSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARAVAAPVVSVSAPAP 214
            |||.|||.|..|.|:||:::|||.:|.|.||||.::||||||:||..| .:|| |||..|.||||
  Fly    75 KSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAV-VKAV-APVAKVLAPAP 137

  Fly   215 VPVHISSAPVASLPA--PIYYPHQQVFAPQQIQQVAEQQGEVVESPVAQQPELEP 267
            : :| :|..||.:||  |...|.....|......:|...|..:  |....|.|.|
  Fly   138 L-LH-ASPLVAKVPAYGPALAPAYPALAHGYGPALAPAYGPAL--PKLALPALSP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 30/51 (59%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.