DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr57A

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:184 Identity:48/184 - (26%)
Similarity:72/184 - (39%) Gaps:37/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRYDFSYGVHDSITGDIKSQ-VETRDGGNVV 162
            :|..:....|.||.|...|...|.|      .:|| |.|||.. ....|.:..| .|..||..|:
  Fly     3 IVLVVCLLAVAAADVSHLVTPEPKV------PASP-YVFSYQA-GRAPGHVDRQHTEVSDGSGVI 59

  Fly   163 -GSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARAVAAPVVSVSA----------PAPVP 216
             |::|.:|.....|||.|.||: :||:..:..:...:|...||.....:|          ..|..
  Fly    60 RGAFSYVDPKNQVRTVQYVADE-HGFHPQLSHKLEDSAAVQAAKQRHFAAYNRIAQEHANHTPGQ 123

  Fly   217 VHISSAPVASLPAP------------IYYPHQQVFAPQQIQQVA----EQQGEV 254
            |.:::||.||....            |...|..:...|:.|::|    .:.||:
  Fly   124 VALANAPHASAAVAHATQKHLSAFERIAAEHAAIGRQQEAQRLALAAQSEHGEI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 19/53 (36%)
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.