DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr56F

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:225 Identity:59/225 - (26%)
Similarity:81/225 - (36%) Gaps:70/225 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLLTVFSLL-AIAASCRAGFAATYAGYHPAYATYQAPAAVYHAAPVAQAAVYQQAAPVYAKTFVP 67
            |..|..:|| .:||...|........|.|...:.|||:..|  .|..|.  ||..    :..::|
  Fly     2 KAFTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNY--LPPTQG--YQSP----SSNYLP 58

  Fly    68 --------AAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVL 124
                    .||  :.||.           ||:|.|...           ..||     |...|:.
  Fly    59 PQRAGGNGGAP--SNSYG-----------APIAPPQGQ-----------YGAP-----ALTGAIF 94

  Fly   125 K----------------------QVELESSP-RYDFSYGVHDSITGDIKSQVETRDGGNVVGSYS 166
            |                      :.|.:..| :|:|.|.|.|..:|:....:|:|||...||.|.
  Fly    95 KGGNGNGNGGYGGGNGNGNGYGQRDEEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYY 159

  Fly   167 VLDADGFKRTVTYTADDINGFNAVVQREPV 196
            ||..||.|:.|.|.||. ||:...::.|.|
  Fly   160 VLLPDGRKQIVEYEADQ-NGYRPTIRYEQV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 23/51 (45%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.