DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr35B

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:65 Identity:38/65 - (58%)
Similarity:43/65 - (66%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQRE 194
            :|...|||.|||.|..|||:|||.|:|.|..|.|.|.::||||.||||.||||...||.|.|.||
  Fly    67 DSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEAHVHRE 131

  Fly   195  194
              Fly   132  131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 31/51 (61%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466426
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.