DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Crys

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:178 Identity:61/178 - (34%)
Similarity:90/178 - (50%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 ELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQ 192
            :.::.|:|.|:|.|.||:|||.|.|.|.|||..|.|.||:::.||.:|.|.|||||::||||:|.
  Fly    70 DYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVS 134

  Fly   193 REPVVAARAVAAPVVSVSAPAPVPVHISSAPVASLPAPIYYPHQQVFAPQQIQQVAEQQGEVVES 257
            ::     |........:||.       :|:...||        :::......|.:||.| .:||:
  Fly   135 KQ-----RLDEQQQQRLSAS-------TSSRFNSL--------EELQTRLTAQAIAEAQ-SLVEA 178

  Fly   258 PVAQQPELEPTPIDYNEG-------------QQQQQEQQQQTYPQDQQ 292
            ..|.|.:||......:|.             |||.|:|:||...|:||
  Fly   179 QQASQLQLEAQNRRESENQARNQAQQLMEQFQQQVQQQEQQRLQQEQQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 28/51 (55%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.