DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr23B

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:251 Identity:84/251 - (33%)
Similarity:115/251 - (45%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGKLLTVFSLLAIAAS----------CRAGFAATYAG------YHP----AYATYQAPAAVYHA 45
            ||.|...:.||..:|.|          .:|..:|:.:|      ||.    |..:...|....:.
  Fly     1 MAAKFFALLSLALLATSQAEYNYNEKEAKAANSASSSGEDFLSDYHTPSNNALNSEATPDGYDYV 65

  Fly    46 APVA-QAAVYQQAAPVYAKTFV--PAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAP 107
            ||.. |.....:.|.|.|...:  .|:.....|..||:|:               ||::....:.
  Fly    66 APARNQFTAGSRTASVQASNLLQNAASAANAESVLLPSPL---------------PVLRHEQNSE 115

  Fly   108 VVAA-------PVVKTVAAAPAVLKQV-----ELESSP--RYDFSYGVHDSITGDIKSQVETRDG 158
            ||::       ..|:...:.|.|:..|     |.|..|  .|.|:|.|:|:.|||||...|||||
  Fly   116 VVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDG 180

  Fly   159 GNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARAVAAPVVSVSAPAP 214
            ..|.|.||::|.||:||||||||||::||||||.|.| .|.:||..||..|:.|.|
  Fly   181 YVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVP-YALKAVVVPVAQVAQPTP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 32/51 (63%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.