DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr31A and Cpr30F

DIOPT Version :9

Sequence 1:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:136 Identity:63/136 - (46%)
Similarity:88/136 - (64%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LAAAPVVAAPVVKTVAA-APAVLKQVELESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYS 166
            :.||..:..|:..:.|| ...:||.||:|:...|||:|.|||..|||||||.|:|.|..|.|.|:
  Fly    12 VGAAAAIELPIYHSPAAIVKPLLKTVEVEAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYT 76

  Fly   167 VLDADGFKRTVTYTADDINGFNAVVQREPVVAARAVAAPVVSVSAPAPVPVHISS----APVASL 227
            ::||||:.|||.||:|..|||||||:|:|:......|||:..:.||||:|:..::    || |.|
  Fly    77 LVDADGYLRTVDYTSDAHNGFNAVVRRDPLGQKVIKAAPIAKLLAPAPLPLAYAAPKLLAP-AKL 140

  Fly   228 PAPIYY 233
            |..:|:
  Fly   141 PLGLYH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 31/51 (61%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466422
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.