DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and pkdc

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:205 Identity:48/205 - (23%)
Similarity:77/205 - (37%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EYNTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSR 187
            |...::||||....|  ..|...::.|..:..|..:|.|||  :.|......|.....|.|    
Zfish   106 EEQLIVLEDLDVAGF--PVRKTYVNDAEIKACLSWIANFHA--LFLDVTPEGLWPIGTYWH---- 162

  Fly   188 DKKAYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESD-------LKT 245
                               ::.:|...||..|:  ||:.          ..||.|       .||
Zfish   163 -------------------LETRPEELEAMSDQ--KLKA----------AAGEIDSILNNCRFKT 196

  Fly   246 LNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE-LVEHH 309
            :.|||....|..|..|..    .|.::|||:........|:.||..:.:.|...:|::. |::::
Zfish   197 IVHGDAKLANFCFSKDGL----QVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLDYY 257

  Fly   310 YKALKANLEK 319
            :..|:.:|||
Zfish   258 FSELRKSLEK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 48/205 (23%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 46/203 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.