DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG18765

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:356 Identity:75/356 - (21%)
Similarity:139/356 - (39%) Gaps:59/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTWLTAAYLQPRLRAYCQDDRLQVLRIW------AKPATGKGENFVGVMTRIYVDYQLGDGSVV 60
            ||||:....|:..::...:..:::.|| |      |:||           ..:::...:.|....
  Fly    16 LPTWVEKKELEALVKQISEFRKIESLR-WKWETQLAEPA-----------LCVHIQVLVADNKKR 68

  Fly    61 NKTYIVKQ----ALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAG---------LDQK 112
            ..:|::|.    .:..::|:...|      :.|..|:|.:||.|:||.|.:.         :..|
  Fly    69 QVSYLIKSPETVPVGLKLPRTGDF------STERHMFEVVLPALEELYQNSDRIVHFGPPVIQAK 127

  Fly   113 LTADAITVDREYNTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLT 177
            |.:..|     |...||.  ..|...|.  :|.|.:...|..|..||.:||.:.....:.|..:.
  Fly   128 LKSSHI-----YGDYILN--KGYSVANG--LKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIR 183

  Fly   178 KCFYTHFFSRDKKAYSVVFAGLFKAFLRFIDG-QPNLKEAYGDKLHKLRTHIMEYGARAYDVGES 241
            :.......|:..:. :.....|::  |||.:. :.|....|.||:...:.:: :.|....| .::
  Fly   184 ELPKLRENSKSDEE-TAELKSLYQ--LRFHESLRSNDARQYEDKVKSFQKYV-KSGTEILD-SKT 243

  Fly   242 DLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESEL- 305
            ....:.:|.||..|::.|.|..|..:..:...|..:.......||.    :||.....:|.|.. 
  Fly   244 SFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLF----SSLLTAPAEKSSRFD 304

  Fly   306 --VEHHYKALKANLEKFSYKGSLPTLQEYRL 334
              |:.::..|..||....:.|..|:|.:.:|
  Fly   305 GYVKFYHDQLIENLNLLKFLGKKPSLTDLQL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 60/301 (20%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 60/290 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459390
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.