DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG10553

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:421 Identity:110/421 - (26%)
Similarity:193/421 - (45%) Gaps:40/421 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTWLTAAYLQPRLRAYCQDDR-LQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYI 65
            :|.|:.....:..|:...:|.: .:.:|  |......|||:..||.||.:|.:..|.:...|.::
  Fly    17 IPDWVKPTVFEELLKRIVKDYKATKSMR--ANAGVAAGENYATVMLRIELDVEKEDNTQTTKAFM 79

  Fly    66 VKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNTMILE 130
            :|....:| ...:|..:.:::..|..||..::|:|::|.::.||:.|..|:...::.....::||
  Fly    80 LKTPHQSE-QYRKVIEKTDIFDVERGMYVEVVPELEQLYRDVGLEVKFGAELYDIEASDYYVLLE 143

  Fly   131 DLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSVV 195
            ||.|..|.|.||::.:|.||||..|:..|::||||.|..|.......|  ||..|.|:::   :|
  Fly   144 DLRPRGFGNIDRLEGMDQAHTECVLKKFAQWHAASAVRVETKGPYQEK--YTKGFLRNEE---IV 203

  Fly   196 FAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGES-------DLKTLNHGDCWT 253
            .|.:.::...|:| ..:|.:.|...|:.||.    ...:.:::.||       :...|||||.|.
  Fly   204 DAFINRSIKVFLD-NVHLCKGYETYLNDLRI----VSGKTFEIVESLNNPSPDEFIALNHGDGWA 263

  Fly   254 TNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE---------SELVEHH 309
            .|||.||:..||.:....:|.|.....|.|.||:||..:|...::...:         ||||:| 
  Fly   264 NNIMSQYNTKGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIWFYHSELVKH- 327

  Fly   310 YKALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPEG 374
                   |:...|..:||||:.......:....|.:........:.....:.:||..:..:  :.
  Fly   328 -------LKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAYVLLDPVDGADFDKVLGD--DD 383

  Fly   375 LRYQKSVYASEAVIRSATKLLAILDAKGLLE 405
            ..::.|:|.:....:....||..|..:|.:|
  Fly   384 CSFKNSLYINPRFRKHMEVLLPWLQHRGAME 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 89/300 (30%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 89/299 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459381
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.