DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG10559

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:420 Identity:110/420 - (26%)
Similarity:209/420 - (49%) Gaps:31/420 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATG--KGENFVGVMTRIYVDYQLGDGSVVNKTY 64
            :||||.|...:..|......:...:...  ||..|  .|||:..:|.|:.::.:|.|.::.|.:|
  Fly    10 MPTWLRANLFEELLSKRYGGNYAGIKSF--KPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSY 72

  Fly    65 IVKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNTMIL 129
            ::|.....|: ..|:..:..::..|.|::..::|:|:::.::.|::.|..|.|..:|...:.::|
  Fly    73 MLKTPYDFEM-YREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDDYVLL 136

  Fly   130 EDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAAS---IVLQERHPNLLTKCFYTHFFSRDKKA 191
            :||.|..|.|.||::.|||.||:..|:.:|::||.|   |.|:..:|....:..|....   |::
  Fly   137 QDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTM---KES 198

  Fly   192 YSVVFAGLFKAFLRFI---DGQPNLKEAYGDKLHKLRTHIME--YGARAYDVGESDLKTLNHGDC 251
            ...|...|.|.||:.:   :|.    |.|...:||::..|::  |.....|  ..|...||||||
  Fly   199 IEQVAETLGKYFLKCLPLYEGY----EEYSAAVHKMQPKIVDLMYAMNTPD--PQDFNALNHGDC 257

  Fly   252 WTTNIMFQY-DDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE-LVEHHYKALK 314
            ||:||||:| |::.||.....:|.|....||...||.||...|.:.|:...:.: .:::::..|.
  Fly   258 WTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLV 322

  Fly   315 ANLEKFSY-KGSLPT---LQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPEGL 375
            .:|...:| :...||   |....|::.|..:.  :|.:..|.::.:.:|: ::.:....|:..|.
  Fly   323 EHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYH--IAFILCPPVLLDRTED-ANLTDFVTETDNGD 384

  Fly   376 RYQKSVYASEAVIRSATKLLAILDAKGLLE 405
            ..:.::|::....:..:.:|..|:.:|..:
  Fly   385 GLKLAMYSNARYKKHVSAILKWLNNRGAFQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 86/294 (29%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 86/294 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.950

Return to query results.
Submit another query.