DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG13659

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:429 Identity:112/429 - (26%)
Similarity:188/429 - (43%) Gaps:78/429 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDG----SVVNKT 63
            |.||...::...||.|.:|..|:|:.:...||:.||:::..:|.|..|:|...:|    |::.||
  Fly    14 PEWLNVQFMTQVLRGYEKDSNLKVINLSFTPASAKGDHYASIMFRARVEYTAQNGNFTKSLIIKT 78

  Fly    64 YIVKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVD-REYNTM 127
            .||::.:     :.::|.:..|:|.|:.||..:||:.:.:|:.|....||..:.|... :.:..:
  Fly    79 MIVEEGI-----KKDMFKDSPLFTTEIGMYTKVLPEWERILRRANDPAKLYVECIYHSLQPHQIL 138

  Fly   128 ILEDLAPYKF-VNADRV---KQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRD 188
            |.:||....: |..||.   :::..|:::     |||.||.|:......|..| |.|........
  Fly   139 IFDDLVEMGYAVVRDRFLTREEISSAYSK-----LAKIHAISMKFIHEQPEYL-KEFKNGLCEMP 197

  Fly   189 KKAYSVVFAGLFKAFLRFIDG-------QPNLKEAYGDKLH---KLRTHIMEYGAR---AYDVGE 240
            ....|.:.:|....|:..:..       ||:.|:.   .||   :||..:.||...   .|:|  
  Fly   198 GLIDSSIISGGMDPFMEMLGRIPELSKYQPHFKKI---SLHFKDRLRETMQEYRNNPQPGYNV-- 257

  Fly   241 SDLKTLNHGDCWTTNIMFQYD-DAGEPRSVVAIDFQFSNCTSPTIDLHYFF-----TTSLREEVG 299
                 |.|.|..:.|:||:.: :.|.....:.:|:|..|.....:||.|..     ....|||: 
  Fly   258 -----LCHADFHSRNMMFKNNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMGPAQRREEL- 316

  Fly   300 DKESELVEHHYKALKANLEKFSYKGSLPTLQEYRLQFERRRFMS-LLAHMFKPC----------- 352
               ..|:.::...|...|:|..|:||:||.|.:..:.:|.|:.. ||...|.|.           
  Fly   317 ---DILLNYYLSILLETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLLLSTFLPVSIGLRTHKLDI 378

  Fly   353 --MIYNGSEETSDFSSLY-----AESPEGL--RYQKSVY 382
              |::|  |||.  ..||     .|..:.:  |:|||.|
  Fly   379 GDMMHN--EETR--KKLYQLEDFMEETKSILDRFQKSGY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 76/312 (24%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 76/312 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459542
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.