DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG11893

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster


Alignment Length:418 Identity:118/418 - (28%)
Similarity:182/418 - (43%) Gaps:42/418 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVK 67
            |.||.|.::...||.|.:...|:|..:...||:.:|:::..||.|...:|....|... |..|:|
  Fly    18 PAWLNAQFITDVLRTYEKCPELEVTDLKITPASAQGDHYASVMFRTTAEYTTSKGKFC-KPLIIK 81

  Fly    68 QALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDRE-YNTMILED 131
            .....|..:.::..:..|::.|::.|...||:.:.:|:|||.|.||....|....| ...:|.||
  Fly    82 TMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEPRQVLIFED 146

  Fly   132 LAPY-KFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSVV 195
            |.|. .||..||  .::|...:.....|||:||.|:.:....|::|....|.........:..:|
  Fly   147 LVPQGYFVIRDR--PINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKDFKYGLMEMPSIMSDPMV 209

  Fly   196 FAGLFKAFLRFIDGQPNL----------KEAY----GDKLHKLRTHIMEYGARAYDVGESDLKTL 246
            ..|: ..||:.:|..|.|          ||.|    ||.:.:.|.::...|   |.|       :
  Fly   210 TTGM-DNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNVQSDG---YYV-------M 263

  Fly   247 NHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHY-FFTTSLREEVGDKESELVEHHY 310
            .|||....|:||..::     .|:.:|||..|....||||.| .:.....|:..|...:|:..::
  Fly   264 CHGDFHGRNMMFNKNE-----EVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYF 323

  Fly   311 KALKANLEKFSYKGSLPTLQEYRLQFERRRFMS-LLAHMFKPCMIYNGSEETSDFSSLYAESPEG 374
            ..|:..|:|..|||.:||......|..|.:|.. .|...|.| ||......|.....| .:.|| 
  Fly   324 SVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSP-MIVAVKANTFKIHEL-IQDPE- 385

  Fly   375 LRYQKSVYASEAVIRSATKLLAILDAKG 402
            :| ||| |..:..::...|||...:..|
  Fly   386 IR-QKS-YLYDPYVQDVKKLLGKYEEMG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 81/301 (27%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 81/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.