DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG31104

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:413 Identity:111/413 - (26%)
Similarity:177/413 - (42%) Gaps:59/413 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVK 67
            |.||.|.::...||.|.|...|:|..:...|||.:|:::..||.|..|:|....|... |..|:|
  Fly    16 PAWLNAQFIGDILREYEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFF-KPLIIK 79

  Fly    68 QALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNT------ 126
            .....|..:.::..|..|:..|:.||...||:.:.:|:|||.:.||....|     |::      
  Fly    80 TMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCI-----YHSLKPRQV 139

  Fly   127 MILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKA 191
            ||.|||.|..: ...|.....:...:|..:.|||:||.|:.:....|..|.:..|..|.......
  Fly   140 MIFEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQYGLFEMPTIDT 203

  Fly   192 YSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIM--------EY-----GARAYDVGESDL 243
            ...:..|:.. |:..:|..|.|:: |.....|::.:.|        ||     ..|.|       
  Fly   204 DPFITTGMTN-FIEMLDKMPELRK-YKHHFEKIKDNYMQRLEVEMHEYHKYRRNDRYY------- 259

  Fly   244 KTLNHGDCWTTNIMFQYD-DAGEPRSVVAIDFQFSNCTSPTIDLHY----FFTTSLREEVGDKES 303
             .|.|||....|:||::: :.|....|:.:|||.||....|:||.|    ......|.|:|:   
  Fly   260 -VLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGE--- 320

  Fly   304 ELVEHHYKALKANLEKFSYKGSLPTLQEYRLQFERRRFMS-LLAHMFKPCMIYNGSEETSDFSSL 367
            .|:..::..|.|.|.|..|||.:||.:|...|.:..::.. .|...|.|.|:...|.:       
  Fly   321 NLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFLISTFLPIMVGVKSND------- 378

  Fly   368 YAESPEGLRYQKSVYASEAVIRS 390
                   |:..:::..|:|.::|
  Fly   379 -------LKMHEALQDSQARLKS 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 82/308 (27%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 82/308 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459538
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.