DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG14314

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:292 Identity:63/292 - (21%)
Similarity:117/292 - (40%) Gaps:45/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KGENFVGVMTRIYVDYQLGDGSVVNKTYIVKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLK 101
            :|:|:...:.||.:..:  ..|:..:..::.:.:...|...|.:...:|:..|:..|..|:|:|.
  Fly    55 RGDNYTAALYRIKLTGK--RRSLKWEQNVICKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELL 117

  Fly   102 ELLQEAGLDQKLTADAI--TVDREYNTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAA 164
            :.............:||  .....::.:|:|||....|..:||.|.|.:..|:..|..:|:.|..
  Fly   118 KFQASKTNQDTPVFNAIPKCYSARHDLLIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGL 182

  Fly   165 SIVLQERHP----NLLTK------C-----FYTHFFSR-DKKAYSVVFAGL------FKAFLRFI 207
            |:..:...|    ||.:.      |     :|.:::.| .|.|..:|...|      ..|..:|.
  Fly   183 SLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFA 247

  Fly   208 DGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTLNHGDCWTTNIMFQYD--DAGEPRSVV 270
            :     ..::..::.||.:            .||.|..:.|||||..|.::.||  |......|.
  Fly   248 E-----SSSFFGRMVKLAS------------TESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVA 295

  Fly   271 AIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE 302
            .:|||....:|..:|:.........:|:.|.:
  Fly   296 LLDFQLIRYSSIALDIANLLYCCTTKEMRDAQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 63/292 (22%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 63/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.