DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG6908

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:430 Identity:112/430 - (26%)
Similarity:204/430 - (47%) Gaps:54/430 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTWLTAAYLQPRL-RAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYI 65
            :|.||.....:|.| |.:....:::..|:  :|..|||||:..::.|...:.:|.|||..:.:|:
  Fly    47 IPAWLDQQKFEPILERDFPDLKKIKSFRL--EPTAGKGENYTTLLLRANFELELNDGSEQSISYM 109

  Fly    66 VKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLT------ADAITVDREY 124
            .|  :.......|....::::.:|.:.|...:|:.:::.::||  :|::      ...|.:|.| 
  Fly   110 AK--ILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAG--KKISFGPRYYESQIELDDE- 169

  Fly   125 NTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDK 189
             .::||||....|.|.||...||:.|||.|||.||:|||||.|..|      .|..|...:::: 
  Fly   170 -LIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFE------LKGSYPEEYNQN- 226

  Fly   190 KAYSVVFAGLFKAFLRFIDGQPNLKE----AYGDKL-----HKLRTHIMEYGARAYDVGES---- 241
                         ....:|....|:|    ||.|..     ..|...:..||::|.|:.:|    
  Fly   227 -------------LCSVVDSLKELRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPK 278

  Fly   242 ---DLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVG-DKE 302
               :.:.|||||.|..|||:|||:||:...|..:|.|.|..:||..||.|...:|...::. .|.
  Fly   279 IEGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKF 343

  Fly   303 SELVEHHYKALKANLEKFSYKGSLPTLQE-YRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSS 366
            ..|::.:::.|..:|:...|...||:|:. ::..|....::..:..:..|.::.:|.:: ::..|
  Fly   344 DYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDD-ANMDS 407

  Fly   367 LYAESPEGLRYQKSVYASEAVIRSATKLLAILDAKGLLEL 406
            |......|.:.:.:::.:..||:...::|.....:|..|:
  Fly   408 LMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFEI 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 88/307 (29%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 88/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.