DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG6834

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:416 Identity:112/416 - (26%)
Similarity:191/416 - (45%) Gaps:20/416 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVK 67
            |.||.....:..|.|:. |...:::....|||...|||:..:|.||.:|.:|.|.|.....:::|
  Fly    62 PEWLNQTQFEELLAAHV-DQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLK 125

  Fly    68 QALSAEVPQAEVFFEY-ELYTREMDMYEFILPKLKELLQEAGLD-----QKLTADAITVDREYNT 126
              :...|||.|..... ..:..|..:|..|||||:||.:..|||     :....|::...:..||
  Fly   126 --VPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEPKLANT 188

  Fly   127 MILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIV-LQERHPNLLTKCFYTHFFSRDKK 190
            :::.||:...|.|.:|::.|::..|:..|:.||:|||||.: :|...|  ....|.......:|:
  Fly   189 VLMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGP--YEDQFVNGVMGGNKE 251

  Fly   191 AYSVVFAGLFKAFLRFIDGQPNLK-----EAYGDKLHKLRTHIMEYGARAYDVGESDLKTLNHGD 250
            .....:.|:..:|...:  ..|||     |.:.:||.|....|.............:...|||||
  Fly   252 VLMAFYEGMVASFRTAL--MANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTADPDEFNVLNHGD 314

  Fly   251 CWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVG-DKESELVEHHYKALK 314
            ||..|::|:.|..||.:.::.:|||.....|||.||.|...||:..:.. |.....:.|:::.|.
  Fly   315 CWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIRHYHEQLT 379

  Fly   315 ANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPEGLRYQK 379
            .:|:...:.|..|:|:|..:...:....::...:....::.....|::.|.:...:|....:::.
  Fly   380 QHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSESSAKFKN 444

  Fly   380 SVYASEAVIRSATKLLAILDAKGLLE 405
            .:|.::.......|||..||.||.||
  Fly   445 LLYTNKRYHGYIEKLLPWLDNKGFLE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 86/297 (29%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 86/297 (29%)
EcKinase 529..813 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.