DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG6830

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:426 Identity:117/426 - (27%)
Similarity:207/426 - (48%) Gaps:34/426 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYI 65
            ::|.||.....:..|.|.. |...:::....|||...|||:..:|.||.:|.:|.|.|....:::
  Fly    45 LVPKWLNQTQFEELLAADV-DQFSKIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFM 108

  Fly    66 VKQALSAEVPQAEVFFEY-ELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVD-----REY 124
            :|  :..:.||.|..... ..:|.|...|..||||::||.:..|||.|....|..:|     :..
  Fly   109 MK--VPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVA 171

  Fly   125 NTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERH---PNLLTKCFYTHFFS 186
            ||:::.||....|.|.:|::.|::..|:..|..||:||||...:.:.|   |::    |......
  Fly   172 NTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDI----FVNGVMG 232

  Fly   187 RDKKAYSVVFAGLFKAF-LRFIDGQPNLK--EAYGDKLHK----LRTHIMEYGARAYDVGESDLK 244
            .:|:|......|:..:| ..|:......|  |.|.:||.|    |....|:.|.    |..::..
  Fly   233 NNKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGI----VDPNEFN 293

  Fly   245 TLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE---LV 306
            .|||||||..|::|:.:.:|:...:|.:|||.....||.:||.||..:|:  ::..|.|.   .:
  Fly   294 ALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSV--QIDYKLSHFDFFI 356

  Fly   307 EHHYKALKANLEKFSYKGSLPTLQE-YRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAE 370
            .|:.:||..:|....:.|..|:|:| :|...:...::........|.::.:.: :::.|.:..::
  Fly   357 RHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPT-QSATFDNFMSD 420

  Fly   371 SPEGLRYQKSVYASEAVIRSATKLLAILDAKGLLEL 406
            |.:|:.::.|:||::.......::|..||.:|.||:
  Fly   421 SADGVSFRGSLYANKRCQEYIERILPWLDNRGFLEV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 90/303 (30%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 90/303 (30%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459388
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.