DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG13813

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:363 Identity:87/363 - (23%)
Similarity:151/363 - (41%) Gaps:62/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AKPATGKGENFVGVMTRI----YVDYQLGDGSVVNKTYIVKQALSAEVPQAEVFFEYELYTREMD 91
            ::|..|.|||..|.:.|:    .||         ..|.:||.|...|..::.:.. .:.|.||:.
  Fly    27 SQPMAGVGENAYGQVLRVSWPTIVD---------AATVVVKMAPRNEARRSHMHV-VDYYAREVF 81

  Fly    92 MYEFILPKLKELLQEAG---LDQKLTADAITVDREYNTMILEDLAPYKFVNADRVKQLDMAHTEL 153
            ||:.:.|..:.|..:..   :...|.|:.:....|:  :|.|||:...|....|...........
  Fly    82 MYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEF--LIFEDLSESGFRPNSRCIMPTYDIVVC 144

  Fly   154 TLEMLAKFHAASIVLQERHP----NLLTKCFYTHFFSRDKKAYSVVF--AGLFKAFLRFIDGQPN 212
            :|:.||:.||.|.:||:..|    .|:......:.|:.|.:..::.|  |.|.||  |.|     
  Fly   145 SLKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKA--RII----- 202

  Fly   213 LKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTLN----------------HGDCWTTNIMFQYD 261
            |||:.||::..::        ....:.|:.||:|.                |||.|..||:::::
  Fly   203 LKESDGDQVAAVQ--------EVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHE 259

  Fly   262 -DAGEPRSVVAIDFQFSNCTSPTIDL-HYFFTTSLREEVGDKESELVEHHYKALKANLE--KFSY 322
             ::.:|.....||||.|....|.:|: ||.|..:.:....:...:.::.:|..:...|:  ..|.
  Fly   260 PNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSL 324

  Fly   323 KGSLPTLQEYRLQFERRRFMSLLAHMFK-PCMIYNGSE 359
            :|..|. ..:..|.::.....|:...|. |..|.|.:|
  Fly   325 EGIYPR-SVFNRQLQQYGVYGLIMGAFSLPFFISNANE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 75/317 (24%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 75/313 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.