DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG11889

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:408 Identity:165/408 - (40%)
Similarity:248/408 - (60%) Gaps:7/408 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNK--TYI 65
            |.|||..|::.:||.|.::|.|.:.::..||||..|||:..|||||.|:|...| |..|:  |::
  Fly    10 PAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKD-SKDNQSATFL 73

  Fly    66 VKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQ-EAGLDQKLTADAITVDREYNTMIL 129
            :|...:.:.|.|.:...|.:||||:||||.|||:|.:::: |....:||.|..:.||||.::::.
  Fly    74 LKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIMF 138

  Fly   130 EDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSV 194
            |||:..::..|.|||:||:.||.|.||.||.||||...|.:|.|.:..|.:...||::..:.|..
  Fly   139 EDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVRGYEP 203

  Fly   195 VFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTLNHGDCWTTNIMFQ 259
            :...:.||..|.:|..|:|||.|..|:.:|..::|:||.|:..|...|..||.|||.||||:|||
  Fly   204 IMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFVTLAHGDIWTTNVMFQ 268

  Fly   260 YDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVG-DKESELVEHHYKALKANLEKFSYK 323
            |||.|.|.:.:.||||||...||.|||.|||:||:.|.:. ::::|||:.::..|...||:..|.
  Fly   269 YDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVALERVKYS 333

  Fly   324 GSLPTLQEYRLQFERRRFMSLLAHM-FKPCMIYNGSEETSDFSSLYAESPEGLRYQKSVYASEAV 387
            |.:|:|.|::.||..:.|.::.|.: |:|.|:|||.||.| .........:|:|.:.:||.:|..
  Fly   334 GKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPS-IEQFMTSDEKGVRLRDAVYQTEEN 397

  Fly   388 IRSATKLLAILDAKGLLE 405
            ::.....|..||..|||:
  Fly   398 LKKLHLTLPFLDQLGLLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 122/288 (42%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 122/288 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449871
Domainoid 1 1.000 166 1.000 Domainoid score I7989
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H115919
Inparanoid 1 1.050 53 1.000 Inparanoid score I4082
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
87.990

Return to query results.
Submit another query.