DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG9259

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:342 Identity:83/342 - (24%)
Similarity:140/342 - (40%) Gaps:45/342 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TAAYLQP-RLRAYCQ----------DDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVV 60
            ||..|.| .:|..||          |....::....||.:.....::|....::|..:|.:...|
  Fly     3 TALELSPTEIRGLCQRYFHQDVSNSDTGFDIVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSEEV 67

  Fly    61 NK-TYIVKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREY 124
            .: |:..|.|......:.|...::.::.:|:.:|:.:||.|.:...|      :.......|:  
  Fly    68 RQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHKACAE------VAPKCYYADK-- 124

  Fly   125 NTMILEDLAPYKF-VNADRVKQLDMAHTELTLEMLAKFHAASIVLQER--------HPNLLTKCF 180
            |.:|.|:||...: :.|.|...|........|:.||..||.||:.::|        .|..:.:..
  Fly   125 NLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENA 189

  Fly   181 YTHFFSRDKKAYSVVFAG---LFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYD-VGES 241
            |....|.:... .|.|..   :.|.|::.|       ..|..||..:..:..|..:..:: |..|
  Fly   190 YPSDVSPEHMR-MVNFQNACLVLKEFIKLI-------PKYQSKLDYVLENFTEKMSFIFEAVKTS 246

  Fly   242 DL--KTLNHGDCWTTNIMFQYDDAGE-PRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE- 302
            |:  .|:.|||.|..||||||...|| |.....:|||.:....|.:|:....|....:|..|.. 
  Fly   247 DVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHL 311

  Fly   303 SELVEHHYKALKANLEK 319
            |||:..:|:.:...|::
  Fly   312 SELLAEYYRFMTEFLKR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 73/301 (24%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 72/286 (25%)
APH <252..325 CDD:279908 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.