DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG33510

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:393 Identity:87/393 - (22%)
Similarity:147/393 - (37%) Gaps:78/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVKQALSAEVPQAEVFFE-YELYTREMDMYEFI 96
            ||| :...|:|....:|..|||.|...|..:.:..:::..:....|.:.| ..|..:|:.:|: :
  Fly    48 PAT-EHTGFLGEYFHLYFQYQLEDQKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLYD-L 110

  Fly    97 LPKLKELLQEA-GLDQKLTADAITVDREYNTMILEDLAP-YKFVNADRVKQLDMAHTELTLEMLA 159
            |.:||:..:.. ......|...:.|.:....|....|.| .:|:|.:::..:        |:.||
  Fly   111 LNELKKFSKHVWSAKCYFTRKDLFVMQNVEDMGYVALPPGTRFLNENQMGPI--------LKSLA 167

  Fly   160 KFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSVVFAGL-FKAFLRFIDGQPNLKEAYGDKLHK 223
            ..||:||..:::....:                     |: |:.:|:.:...|.: |.|...|..
  Fly   168 TLHASSIAYEKQQGKTI---------------------GVEFRKWLKEVSVDPEV-EWYTTGLRA 210

  Fly   224 L------------RTHIMEYGA----RAYD-----VGESDL--KTLNHGDCWTTNIMFQYDDAGE 265
            :            .....||.|    |..|     |..|.:  ....|.|.|..|:.:..:...|
  Fly   211 VLAVAAIHPDVLDNPEAQEYIAQELPRCLDKVYCMVNPSPVHRNVFVHRDAWNANVFYHKEKPHE 275

  Fly   266 PRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE---SELVEHHYKALKANLEKFSYKGSLP 327
            .||:: :|||....:.|.:|.|  ..|.|..|...::   ..|:|.:|.||   .|:|...|..|
  Fly   276 ERSIL-VDFQLCRYSPPAMDFH--LVTYLNLEPFSRKKMIGSLIETYYDAL---AEEFREMGVNP 334

  Fly   328 TLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEET------SDFSSLYAESPEGLRYQKSVYASEA 386
                |:.|..::.|...|.........||....|      :...:|..|.||......:|..|..
  Fly   335 ----YQEQLSKQEFEQSLNDFSLFGATYNCIAATVLRLPDNYLKNLKDERPEDFHRFCNVDRSAD 395

  Fly   387 VIR 389
            |:|
  Fly   396 VLR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 67/314 (21%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 50/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459496
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.