DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG33511

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:378 Identity:93/378 - (24%)
Similarity:162/378 - (42%) Gaps:64/378 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FVGVMTRIYVDYQL-GDGSVVNKTYIVKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELL 104
            ::|...:::::.:: ||.......|.:|.......||.|......::.:|..:|..||||:    
  Fly    42 YMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKI---- 102

  Fly   105 QEAGLDQKLTADAITVDREY---NTMILEDLA-PYKFVNADRVKQLDMAHTELTLEMLAKFHAAS 165
                  ||.....:.....|   :.::||||. .|:.:.|:....||  |.::.||.|::.||||
  Fly   103 ------QKYATKKLYPKCYYSRNDILVLEDLTQDYRHLRANEYYTLD--HYKIVLEHLSELHAAS 159

  Fly   166 IVLQER--------HPNLLTKCFYTHFFSRDKKAYSVVFAGLFKAFLRFIDGQPNLKEAYG---- 218
            |..:|:        :.|:|.:   .|..|.:    |....|| ||.:......|:.:....    
  Fly   160 IAWEEKENVKIYESYKNVLIE---LHLDSNN----SWYITGL-KAIVFLAARNPHFQTMKAQNFI 216

  Fly   219 -DKLHKLRTHIMEYGARAYDVGESDLKTLNHGDCWTTNIMFQYDDAGE--PRSVVAIDFQFSNCT 280
             |||:.|.|...|..|.:..:    ...|.|.|.|..||::.::....  |.:...:|||.:...
  Fly   217 QDKLYNLLTKAEELVAPSKTI----RNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYC 277

  Fly   281 SPTID----LHYFFTTSLREEVGDKESELVEHHYKALKANLEKFSYKGSLPTLQEYRLQFERRRF 341
            |||:|    |:...:..:|..:.|   |.:||:||.|:.:|::.....:|.|...:|.:.:|.|.
  Fly   278 SPTLDVLFLLYIVASAEVRRAIYD---ECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTRL 339

  Fly   342 MSLLAHMFKPCMIYNGSEETSDFS-----SLYAESPEGLRYQKSVYASEAVIR 389
            .:|        :|:..:|..:..|     .|.:|.||...|..:...||.::|
  Fly   340 AAL--------VIWALTEPQTKMSPSISNRLRSEEPEKFDYYLNCDRSELLLR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 76/304 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 76/303 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.