DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG31300

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:420 Identity:112/420 - (26%)
Similarity:187/420 - (44%) Gaps:40/420 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVK 67
            |.||...:::..|.||.....|:|:.:...||:.:|:::..||.|...:.....|. .::..|:|
  Fly    18 PAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGK-FSRPLIIK 81

  Fly    68 QALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDRE-YNTMILED 131
            .....:..:.::..|..|:..|:.||..:||:.:.:|:|:|.|.||....|....| ...||.||
  Fly    82 AMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKVMIFED 146

  Fly   132 LAPY-KFVNADRVKQLDMAHTEL--TLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYS 193
            |.|. .:|..||    .:|..||  ....|||:||.|:...:..|:.|.:..|..|.....|...
  Fly   147 LVPQGYYVIRDR----PVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDP 207

  Fly   194 VVFAGLFKAFLRFIDGQPNLK------EAYGDK-LHKLRTHIMEYGARAYDVGESD-LKTLNHGD 250
            .:..|: ::|:..:|..|.|:      |...|| :.:|:..:.||    ::..:|| ...|.|||
  Fly   208 FITTGM-QSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEY----HENRKSDAFYVLCHGD 267

  Fly   251 CWTTNIMFQYD-DAGEPRSVVAIDFQFSNCTSPTIDLHY----FFTTSLREEVGDKESELVEHHY 310
            ....|:||:.: ..|.....:.:|||.||....||||.|    ......|.|:|   .:|:.|:.
  Fly   268 FHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMG---KDLINHYL 329

  Fly   311 KALKANLEKFSYKGSLPTLQEYRLQFERRRFMS-LLAHMFKPCM--IYNGSEETSDFSSLYAESP 372
            ..|.|.|:...|.|.|||..:...:..:.::.. .|...|.|.:  |.:.|.:.:|.    .:.|
  Fly   330 TVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDL----IQDP 390

  Fly   373 EGLRYQKSVYASEAVIRSATKLLAILDAKG 402
            |   .::..|..:..::..:|||...:..|
  Fly   391 E---TRQKTYFLDTYVKDVSKLLPKFEQLG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 84/301 (28%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 84/301 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459537
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.