DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG31099

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:422 Identity:105/422 - (24%)
Similarity:190/422 - (45%) Gaps:47/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIV 66
            :|.|:::..|...:.:..:|. :|:..:.......:..|.. |:..|.|..||.|.::....:::
  Fly     6 IPDWVSSLSLNQAVHSVLEDG-VQITSVIPSVHLIQFRNCT-VLLPIQVKVQLRDFTMKKLFFLL 68

  Fly    67 KQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNT--MIL 129
            |.....:: ||.|..:.:::.||..:|..:||||:|:.:|.|........|..:|.....  ::|
  Fly    69 KAQHGTDI-QAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLL 132

  Fly   130 EDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERH---PNLLTKCFYTHFFSRDKKA 191
            |||....:.|.:|....:....:..|:.||:|||||.|..|:|   .|||....||       ||
  Fly   133 EDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYT-------KA 190

  Fly   192 YSVVFAGL-----FKAFLRFIDGQPNLKEAYGDKLHK----LRTHIMEYGARAYDVGESDLKTLN 247
            ...|...|     |.:.||        :...||..||    ....:::...:.:....::...||
  Fly   191 NESVLQELNDPEIFLSQLR--------RWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLN 247

  Fly   248 HGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE-SELVEHHYK 311
            |.|||..|:||::||:|.......:|:|.....||.|||:|...:|..:::...: ..:|::::.
  Fly   248 HSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFY 312

  Fly   312 ALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMF----KPCMIYNGSEETSDFSSLYAESP 372
            .|..||:..::.||||.||..|....:.   .|.|::.    .|..:.|..|:  :.:..||.  
  Fly   313 HLLDNLKALNFGGSLPQLQHIRDALNKN---GLAAYVVVTRALPITMMNQFED--EVNERYAS-- 370

  Fly   373 EGLRYQKSVYASEAVIRSATKLLAILDAKGLL 404
               :.:.:::.|...|::...:|..::.:.||
  Fly   371 ---KMKCAMFTSRKYIQAIKDILPWMEERSLL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 81/299 (27%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 80/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459386
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.