DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and CG31436

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:426 Identity:109/426 - (25%)
Similarity:182/426 - (42%) Gaps:49/426 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVK 67
            |.||.:.::...|.....:..::|:.:...||:.||:::..:|.|..|.|....|. ..|:.|:|
  Fly    18 PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNRKGE-FQKSLIIK 81

  Fly    68 QALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDRE-YNTMILED 131
            ....||..:.::.....::..||.:|..:||:.:.:|::.|.|.:|..:.|....| :..:|.||
  Fly    82 TMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLEPHQVLIFED 146

  Fly   132 LAPYKF-VNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSVV 195
            ||...: |..||...||  ........|||:||.|:.:|...|..|..  |||            
  Fly   147 LAEMGYIVLRDRDATLD--EIRRIYFKLAKWHAVSLKVQNEQPEFLES--YTH------------ 195

  Fly   196 FAGLFKA---------------FLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAY-DVGESDLK 244
              |||:.               |:..:..:|.|.: |......::...:|.....: |:.:|..|
  Fly   196 --GLFEMPHVLNDPFMRTGMEFFVELLGKEPELNK-YKPYFESIKDDFLERLVEEWKDIRKSQKK 257

  Fly   245 ----TLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLR-EEVGDKESE 304
                .|.|||....||||::.|.......:.:|||.||....|.||.|.....|. |...:...:
  Fly   258 DEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDD 322

  Fly   305 LVEHHYKALKANLEKFSYKGSLPTLQE-YRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLY 368
            |:.::...|:..|:|..|||.:|:... ::...:.:.:...|...|.|.| :...:::.||..|.
  Fly   323 LINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLM-WALRDKSVDFGDLL 386

  Fly   369 AESPEGLRYQKSVYASEAVIRSATKLLAILDAKGLL 404
            ....:    ::....|:..|:..|.|||.||..|||
  Fly   387 QNEEK----RRKCSFSKGYIKEVTILLARLDQLGLL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 80/307 (26%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 80/307 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459541
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.