DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and nhr-246

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:391 Identity:82/391 - (20%)
Similarity:146/391 - (37%) Gaps:119/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLRAYCQDDRLQ---VLRIWAKPATGKG----ENFVGVMTRIYVDYQLGDGSVVNKTYIVKQALS 71
            ::|.:..:|.|.   ||:|   |...||    ||..|.:..:       |.|||           
 Worm    49 KVRLHFDNDDLPKHVVLKI---PQNTKGCSVVENAGGGVKNV-------DHSVV----------- 92

  Fly    72 AEVPQAEVFFEYELYTREMDMYEFILPKLKE---------LLQEAGLDQKLTADAITVDREYNTM 127
                      |..::..|.:.|: :...|.|         |..:||  :|.....|.::      
 Worm    93 ----------ERFMHNTECNYYK-LFSSLSEKPLQIPTTYLASKAG--EKAPVPVIVLE------ 138

  Fly   128 ILEDLAPYKFV---NADRVKQLDMAHTELTLEMLAKFHAASIVLQE-----RHPNLLTKCFYTHF 184
            :|||...:..:   |.|::.::        ::.|.|.|..|:..::     ...:.|....:...
 Worm   139 MLEDCKLHDLIPGFNEDQLFKI--------VDELVKLHIFSLTTEKWKEIVPDESKLAMSGFLQC 195

  Fly   185 FSRD---KKAYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTL 246
            ...|   |.|.:.....:.......:|..||.       |.|:|.   ||      :.|.....:
 Worm   196 MVADVGRKLAQNPELGVILSYVENTLDTDPNY-------LQKMRD---EY------INEERPSVI 244

  Fly   247 NHGDCWTTNIMFQYDD--AGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKES---ELV 306
            .|||.|...|::..:|  ||      .:|:|.::..||..|||:..:|.  ..|.::::   .|:
 Worm   245 CHGDLWAPQILWDKEDNIAG------IVDWQATHRGSPMEDLHHILSTC--TSVQNRKTFTKPLL 301

  Fly   307 EHHYKALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAES 371
            :|:|..||..|::..:|.:. |.:|..:::.         :.|    || |:..|...:..:|.|
 Worm   302 DHYYNKLKVGLKEKGFKTTW-TREEIDIEYN---------YSF----IY-GASRTIFANGFWANS 351

  Fly   372 P 372
            |
 Worm   352 P 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 64/313 (20%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 46/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.