DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and H06H21.8

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:421 Identity:78/421 - (18%)
Similarity:140/421 - (33%) Gaps:126/421 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KGENFVGVMTRIYVDY--QLGDGSVVNKTYIVK-QALSAEVPQAE-------------------- 78
            |.||.....:.|||.:  .:|||..|.::..:| ..:|..|.:.|                    
 Worm    32 KLENAKSFWSEIYVAHLKVVGDGVKVPESVFIKVPRISENVLRCEDESAVNHLNDVLLYYSKKEN 96

  Fly    79 VFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNTMILEDLAPYKFVNADRV 143
            :|:::..|.   .:..|..||:.       ..:.:..:|.      ..::.|:|:...|. .:.:
 Worm    97 LFYKHFEYG---SIPNFPFPKVY-------FTEDINGEAT------GGIVAENLSEKVFA-VEHI 144

  Fly   144 KQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSVVFAGLFKAFLRFID 208
            ..|........:|.||..|                   :....||.|:|...|.........|.:
 Worm   145 PGLKHEQILRLMEALAGLH-------------------SFLMKRDDKSYVESFVEGAHGRETFSE 190

  Fly   209 GQPNL------------KEAYG-DKLHKLRTHIMEYGARAYDVGESDLKTLN----------HGD 250
            |..|:            .|.:| |::..::.        ::|....:..|.:          |.|
 Worm   191 GMQNMMFEEALTLENVSPEVFGNDRIRNIKW--------SFDYSIKNKATADAISAFPGIICHAD 247

  Fly   251 CWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE-LVEHHYKALK 314
            ...||::::.|.|.:..|.: ||:|.....|...|:....|..|..|:..|.:: .::|::|   
 Worm   248 LNVTNVLWKKDSAKDEISAI-IDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNYLDHYHK--- 308

  Fly   315 ANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFS-----SLYAESPEG 374
                      :|..|...:..|.    |..|.|.:.  :||..|...|.|.     .:|::...|
 Worm   309 ----------TLTELSNGKAPFS----MEELLHQYS--LIYPFSSNFSLFGIALYIKMYSDGTLG 357

  Fly   375 LRYQKSVYASEAVIRSATKLLAILDAKGLLE 405
            ....|.....|.:.|          |.|::|
 Worm   358 NPEDKEENCKELIDR----------ALGIVE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 59/331 (18%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 40/224 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.