DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and F20D6.5

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_505104.3 Gene:F20D6.5 / 184724 WormBaseID:WBGene00017635 Length:376 Species:Caenorhabditis elegans


Alignment Length:414 Identity:89/414 - (21%)
Similarity:155/414 - (37%) Gaps:109/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AYCQ----DDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVKQALSAEVPQA 77
            |:|.    ::.:...::.....||||   :....::..:.|.| |:|:.|      ...||..::
 Worm     6 AFCYGKAIEEMVAEFKVVEDVGTGKG---MLSCVQLVFEEQYG-GNVILK------IPGAEAARS 60

  Fly    78 EVFFE----YELYTREMDMYEFI---------LPKLKELLQEAGLDQKLTADAITVD-------- 121
            .:|..    .:|:..|:|.|.|:         .||:.||       :|:.   |:||        
 Worm    61 RLFIGDDTFCKLHNTEVDAYTFLQKFSDKNISYPKIYEL-------EKMD---ISVDPIKQGHII 115

  Fly   122 REYNTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERH----PNLLTKCFYT 182
            .||.:.|.. |..|..:..|.:.:        .::.||:||:....|.|..    |......::|
 Worm   116 MEYMSGITH-LYCYNNLKPDELIE--------PVKNLARFHSIGAELDEEEGSNVPRDFLSSWFT 171

  Fly   183 HFFSRDKKAYSVVFAGLFKAFLRFIDGQPN------LKEAYG----DKLHKLRTHIMEYGARAYD 237
            ..|::..|.   .|.|.:|..|.  |..|:      :||..|    :...||.......|.:   
 Worm   172 TLFTQQNKN---TFIGNWKGDLS--DWLPSKVARDTIKELDGLLTPEIFLKLNNDCQLTGVQ--- 228

  Fly   238 VGESDLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLR-EEVGDK 301
                  :.|.|||....|::::....|..:....:|||..|..:...||...|.|::. ::..|.
 Worm   229 ------EVLCHGDYSFHNLLYEKHCDGSYKFRAIVDFQSVNWGNAAQDLSRLFVTAMSGKDRRDS 287

  Fly   302 ESELVEHHY----KALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNG----- 357
            |..|::.:|    |..|.|:..|:::         :|:....||..|  |....|.:..|     
 Worm   288 EDRLLKIYYDELIKVSKGNVAPFTWE---------QLKQSYTRFFQL--HAAIVCTVTPGLFLVT 341

  Fly   358 ------SEETSDFSSLYAESPEGL 375
                  .:|..:|.::..|...||
 Worm   342 LSGKHEGKEKVEFRNIMIEKYVGL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 73/324 (23%)
F20D6.5NP_505104.3 PKc_like 11..369 CDD:389743 87/409 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.