DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and E02C12.9

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:388 Identity:82/388 - (21%)
Similarity:138/388 - (35%) Gaps:112/388 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KPATGKGE-----NFVGVMTRIYVDYQLGDGSVVNKTYIVKQALSAEVPQAEVFFEYELYTREMD 91
            |.||...|     :.:.::...:||.:.|                ..||.....:..:.:..|.|
 Worm    38 KNATNISEMKGYMSIIALINADWVDVEKG----------------KNVPSKFAVYGLKKFIDEND 86

  Fly    92 MYEFILPKLKELLQEAGLDQKLTAD-AITVDREYNTM--ILEDLAPYKFVNADRVKQLDMAHTEL 153
            |..|::........:.|:...:.|| .|.:.|..:|.  :.|.|       :|..|         
 Worm    87 MKGFLIVDFVSNAHDVGMYLSIPADELIPLVRGISTFSALGEKL-------SDNEK--------- 135

  Fly   154 TLEMLAKFHAASIVLQERHPNL-----LTKCFYTHFFSRDKKAYSVVFAGLFKAFLRFIDGQPNL 213
                  ||...|..|:.....|     |.|.|...:...:|:.|..| .||.:.|:.:       
 Worm   136 ------KFAGGSDFLERMFSQLFNSSSLQKHFQGMYSVFEKEKYYQV-DGLIETFVVY------- 186

  Fly   214 KEAYGDKLHKLRTHIME-YGARAYDVGESDLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFS 277
                 .||.|..|.|.| .|.::         .|||||.|.:|::...::.|:.:....||:|.:
 Worm   187 -----QKLLKKYTKISELLGFKS---------VLNHGDLWQSNMIHSMENNGKLKLEAIIDWQST 237

  Fly   278 NCTSPTIDLHYFFTTSL-REEVGDKESELVEHHYKALKANL---EKFSYKGSLPTLQE-YRLQFE 337
            ....|.:|........| .|:..:|..:|:..::|.. .|:   |.||::    .||: |.|.| 
 Worm   238 VILPPGLDTAELIVGCLSAEDRREKGHDLLLLYHKTF-INVFGSEVFSFE----ELQDSYNLYF- 296

  Fly   338 RRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPEGLRYQKSVYASEAV-IRSATKLLAILD 399
                 .:.|.:..|.||                     .:..:...:||. |.|.:|:.||::
 Worm   297 -----PMAAILIVPGMI---------------------SFMTNTQITEAERIHSMSKITAIVE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 62/302 (21%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 82/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.