DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and C29F7.2

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans


Alignment Length:332 Identity:69/332 - (20%)
Similarity:117/332 - (35%) Gaps:121/332 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IVKQALSAEVPQAEV------FFE----YELYT--REMDMYEFILPKLKELLQEAGLDQKLTADA 117
            ::..|:.||..:|.|      .||    |::.|  .|..:|:.:    .|::       ||...:
 Worm   126 VIYAAIKAEDKEAPVPVIVMEMFEDCKVYDIITGFNEEQLYKIV----DEIV-------KLHIFS 179

  Fly   118 ITVDREYNTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQER---HPNL-LTK 178
            :|.: |:.|::     |..||                |||...|......:.|:   .|.| |..
 Worm   180 LTTE-EWKTIV-----PDAFV----------------LEMAGYFQTMVAGIGEKLAQQPGLELVS 222

  Fly   179 CFYTHFFSRDKKAYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDL 243
            .:..:.|:.|.|            ||:      |:.:.|                    :.|..:
 Worm   223 TYIKNTFATDPK------------FLQ------NINDEY--------------------LEERRI 249

  Fly   244 KTLNHGDCWTTNIMFQYDD--AGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLR-EEVGDKESEL 305
            ..|.|||.|...|::..:|  ||      .||:|.::..||..|.|:..:|... |...:....|
 Worm   250 SVLTHGDLWAPQILWDKNDDIAG------IIDWQITHRGSPMEDFHHIMSTCTSVENRKNLTKPL 308

  Fly   306 VEHHYKALKANLEKFSYKGSLPTL-----QEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFS 365
            :::::..|.:.||....|  :|..     :||:..|                  .||:..|...:
 Worm   309 LDYYFDKLSSGLEAKGVK--MPWTREEIEEEYKYSF------------------INGAALTIFAN 353

  Fly   366 SLYAESP 372
            ..:|.||
 Worm   354 GFWANSP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 58/275 (21%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 51/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.