DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and T16G1.5

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_506235.1 Gene:T16G1.5 / 179775 WormBaseID:WBGene00011799 Length:434 Species:Caenorhabditis elegans


Alignment Length:436 Identity:89/436 - (20%)
Similarity:155/436 - (35%) Gaps:129/436 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKGENFVGVMTRIYVDYQLGD-----------GSVVNKTYIVKQALS------AEVPQAEVF--F 81
            |.|..|:..:..:..|:.:.:           .|.:|..::|.|...      .|..:||::  |
 Worm    49 GDGNGFMSRVVLVEADWTIPNENLPEKIILKLTSCINVHHLVSQMKEKNPDAFTEQQEAELWAMF 113

  Fly    82 EYE---LYTREMDMYE----------FILPKLK-------ELLQEAGLDQKLTADAITVDREYNT 126
            |.|   ::.||:::|.          .:.||:.       |...:..|..:...||: |...|..
 Worm   114 EREAQNVHNREVNLYRITEKWNKNDALLSPKIYFYKKFDCENKTQGVLGMEYVDDAV-VRHLYCN 177

  Fly   127 MILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKA 191
            ....:|.|                   .|:.||...|.|:.|.|...|.::             .
 Worm   178 AKPHELHP-------------------ILQSLATLQAGSLHLTEDEINSIS-------------G 210

  Fly   192 YSVVFAGLFKAFLRFIDGQPNLKEAY-------GDKLHK----------------LRTHIMEYGA 233
            |.      ||:.:..:..:..:|:.|       .::|.|                :..|:.:|..
 Worm   211 YD------FKSMVGRMMSEEGMKQMYTRARQINPERLTKPTDAVEALGMDIVNFEISCHVNKYAG 269

  Fly   234 RAYDVGESDLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEV 298
            ...:|       |.|||.|..||:::.:|.....|.| ||:|..:..:|..||...|.::|  ..
 Worm   270 IQKNV-------LVHGDLWAANILWKENDGNCVASKV-IDYQLIHMGNPAEDLVRVFLSTL--SG 324

  Fly   299 GDKES---ELVEHHYKALKANLEKFSYKGSLPTLQE-YRLQFERRRF--MSLLAHMFKPCMIYN- 356
            .|:::   :|:|..|:.....||......:|..|:| |||.|.....  |.|...:.:..:.|: 
 Worm   325 ADRQAHWEKLLEQFYEYFLEALEGNEAPYTLDQLKESYRLYFVGGGLFVMPLFGPVAQAKLSYST 389

  Fly   357 GSEETSDFSSLYAESPEGLR--------YQKSVYASEAVIRSATKL 394
            .:|...::..:..|..|.|.        |.|.|...   :.:|.||
 Worm   390 DNENVEEYREVLTEKAERLMEDLKRWHLYSKDVTKD---LETAEKL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 68/349 (19%)
T16G1.5NP_506235.1 DUF1679 8..420 CDD:369592 84/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.