DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33301 and F59B1.8

DIOPT Version :9

Sequence 1:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:323 Identity:61/323 - (18%)
Similarity:99/323 - (30%) Gaps:155/323 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YVDYQLGDGSVVNKTY----------IVK-----QALSAEVPQAEVFFEYELYTREMDMYEFILP 98
            :|..:..:||||...|          |:|     ||||......          |.:|..|....
 Worm   157 FVGMEFVEGSVVRHCYENVTVDELQPILKALARLQALSLSTESC----------RNLDNGEAFEE 211

  Fly    99 KLKELLQEAGL----------DQKLTADAITVDREYNTMILEDLAPYKFVNADRVKQLDMAHTE- 152
            .|.::|.|.||          ||||                          :::|::::..|.| 
 Worm   212 SLMDMLSEDGLKGIFDQSRNIDQKL--------------------------SEKVERIEQNHKEI 250

  Fly   153 LTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSVVFAGLFKAFLRFIDGQPNLKEAY 217
            |.||.:.                                                    ||.:..
 Worm   251 LNLETVL----------------------------------------------------NLNKVV 263

  Fly   218 GDKLHKLRTHIMEYGARAYDVGESDLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSP 282
            |                      .|.|.:.|||.|..||::...|.|.....| :|:|.|:..:|
 Worm   264 G----------------------IDQKVICHGDLWAANILWTQTDGGFIADKV-LDYQESHMGNP 305

  Fly   283 TIDLHYFFTTSLREEVGDKESELVEHHYKALKANLEKF-SY------KGSLP-TLQEYRLQFE 337
            ..||.....:::  ...|::|     |::.:   ||:| :|      ..:.| ||::.:..|:
 Worm   306 AEDLVRLLVSTI--SGADRQS-----HWEHI---LEQFYTYFTDEIGSNNAPYTLEQLKTSFK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 56/299 (19%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 61/323 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.