DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33306 and CG7968

DIOPT Version :9

Sequence 1:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_609684.1 Gene:CG7968 / 34802 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster


Alignment Length:247 Identity:55/247 - (22%)
Similarity:112/247 - (45%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIVALASCQGAEVAEPLSAQGRSFSSVIVDGLEAFRVVLQNGSPRFGIPVMAPMKAAQRSFEINS 73
            :.|||..|.        ....:.|...:.:..|..|:.::.|.|..|:|::||.:.|.:...|.:
  Fly     7 IFVALLCCS--------LGSAKLFDDELRELTEFLRLQMRCGYPARGVPILAPAQMAYKEIGIRT 63

  Fly    74 GEFSGTFGVENFELQGLDQYEIITMNMDVIRSRLTFNINFASLNF-TTDYEMDM-----GSGYRI 132
            ..|.......:..::|||.||...:..:.|...:.|::||..::. :|:|::::     |:.:.:
  Fly    64 ENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHTIKFDMNFPKISLKSTNYKLNLLARLFGADFSL 128

  Fly   133 KRNGGAFFALEDLNIQGRISYSL-------GVFTSQLRVKDVLIYPSVGNVNSQIENLSKYRIFN 190
            ..:|.  .:||.:|.:...|:.:       ||:....:|...|     ....||.......|::.
  Fly   129 WGDGA--LSLELINFRAYGSFVIRPKSATSGVYAKSWKVNWEL-----EEAKSQTTGFMNSRLYT 186

  Fly   191 RKLNEIIEEFVTLTINENTDFVAAWVSEQATPICNDLIGDRTLSDIIAIITG 242
            :.:|::|.|::.:.||:|...|:.::.|...|..|.::.:....:|.|||.|
  Fly   187 KFINDLIVEYLDIMINDNPTEVSQFMEELIVPPMNLVLDNLAWYEITAIILG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33306NP_995706.1 JHBP 16..230 CDD:299906 47/226 (21%)
CG7968NP_609684.1 JHBP 5..234 CDD:214779 51/241 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.