DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33306 and CG7916

DIOPT Version :9

Sequence 1:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_609682.1 Gene:CG7916 / 34800 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster


Alignment Length:271 Identity:56/271 - (20%)
Similarity:107/271 - (39%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSAFLIALIVALASCQGAEVAEPLS----------------AQGRSFSSVIVDGLEAFRVVLQN 49
            ||:  ::.:.|.|.:|..|...|.|:                .||...:..:...:......:..
  Fly     1 MKA--IVCVFVTLLACVAAYDVELLTEEQWDQLVARNPAKPDTQGLILNGSVKKAINGLLNQMPC 63

  Fly    50 GSPRFGIPVMAPMKAAQRSFEINSGEFSGTFGVENFELQGLDQYEIITMNMD-VIRSRLTFNINF 113
            |.|::|||.:.|...|.....:.............|...||:..||..|.:. ....::.|:.||
  Fly    64 GWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMKVSYTFSKKVKFHFNF 128

  Fly   114 ASLNFTTDY---------EMDMGSGYRIKRNGGAFFALEDLNIQGRISYSLGVFTSQLRVKDVLI 169
            ..|..:..|         ..::|...|.:.:|...|:|::|:|||...|.:......:::.....
  Fly   129 PELKASAHYLDTNTFVNLLKELGLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGSIKIYKFSC 193

  Fly   170 YPSVGNVNSQIENLSKYRIFNRKLNEIIEEFVTLTINENTDFVAAWVSEQATPICN-DLIGDRT- 232
            ...:|.|:|.|..:......|..:|:::::.:...||.|.:.::|.:.|...|:.| .|.|.:. 
  Fly   194 AVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANAHLTGHKIW 258

  Fly   233 -LSDIIAIITG 242
             |..:::..||
  Fly   259 YLFSLLSATTG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33306NP_995706.1 JHBP 16..230 CDD:299906 48/240 (20%)
CG7916NP_609682.1 JHBP 33..262 CDD:214779 46/228 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.