DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and CG7031

DIOPT Version :9

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001287474.1 Gene:CG7031 / 42704 FlyBaseID:FBgn0039027 Length:475 Species:Drosophila melanogaster


Alignment Length:160 Identity:55/160 - (34%)
Similarity:86/160 - (53%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ASEHSGEGYGDGYGYGGSGGGGSGSLGS--GGGGDGHFHHHTPTTYSEISKHVPVHVIEKVPLPI 98
            :|..||.|..|...:..:|...|.:..|  .|.|.||.||   :.:.:|..:|||..::|..:|:
  Fly   318 SSASSGSGADDFEEHPDAGQEQSSNYLSEASGHGQGHTHH---SHHVDIINYVPVKHVKKQHVPV 379

  Fly    99 PHPVAVQVPNVIRLQIPEPYAVHVPVQQEIHVPVYKIVPEITEKKIPYTVEKPYPVEVEKPYPVE 163
            ...|.:.:.:.:.:.:.:|..:|:|:.:.:||||.|.:....|:.||..|||..||.|||..|..
  Fly   380 EKEVKIPISHAVIIPVRKPVPIHIPITKNVHVPVEKELKVPVERLIPVPVEKHIPVPVEKHVPYH 444

  Fly   164 VIKQIKIPVPKPYPVPFTIYKHVLQKEHGW 193
            |:|.:.|.||||:||...::|.||.|...|
  Fly   445 VVKYVPIKVPKPFPVKVPVFKTVLHKVKSW 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 27/60 (45%)
CG7031NP_001287474.1 IMCp 398..>469 CDD:289112 31/70 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BX3N
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.