DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and Vajk3

DIOPT Version :9

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster


Alignment Length:256 Identity:74/256 - (28%)
Similarity:102/256 - (39%) Gaps:104/256 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QLLICSIQLI----CASEHSGE----------------GYGDGY-----GYGGSGG-GGSGSLGS 63
            ::.||...|:    |||:..||                |||.|:     ||.|.|. .|.||.|.
  Fly     2 KVFICLAALLVASACASKTEGEKVPLEKKLDKRGLLDLGYGYGHAGLDTGYLGHGSISGHGSYGH 66

  Fly    64 GGGGDGHF-----------------H-------HHTPTTYSEISKHVPVH----VIEKVPLPI-- 98
            |.|..|:.                 |       ||.|..| .|||...||    :.:.:|:|:  
  Fly    67 GYGLTGYSAPAAVAVGHSGPAIAVGHTAPAVAVHHAPAPY-VISKQADVHKTITITKGIPVPVHV 130

  Fly    99 --PHPVA--VQVPNVIRLQIPEPY--------------AVHVPVQQ----------EIHVPVYKI 135
              |:||.  .:||..:::.:|:||              .|.|||.|          .:||||   
  Fly   131 DRPYPVVHEKRVPVEVKVPVPQPYEVIRKVPVTVKEYVKVPVPVPQPYEVIRHEKVPVHVPV--- 192

  Fly   136 VPEITEKKIPYTVEKPYPVEVEKPYPVEVIKQIKIPVP----KPYP-------VPFTIYKH 185
                 ::.:|..|.:||||.|.|||||.|.|.:.:.||    :|||       |..::.||
  Fly   193 -----DRPVPVEVPRPYPVPVAKPYPVYVEKAVNVQVPVHVDRPYPVYVKVPVVSHSVVKH 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 27/81 (33%)
Vajk3NP_609690.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.