DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and Vajk2

DIOPT Version :9

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_609689.3 Gene:Vajk2 / 34811 FlyBaseID:FBgn0032538 Length:270 Species:Drosophila melanogaster


Alignment Length:223 Identity:75/223 - (33%)
Similarity:101/223 - (45%) Gaps:63/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LQHWIVFQLLICSIQLICASEHS------------------GEGYGDGYGYGGSGGGGSGSLGSG 64
            ::..::|.|:...:.:..|||.:                  |.|:|.|||||.|.||  ..||||
  Fly     1 MKSMLIFGLVAMCVLVANASEEAPKKAVETAEPAEKKQEKRGIGHGLGYGYGPSAGG--AILGSG 63

  Fly    65 -GGGDGHFHHHTPTTYSEISKHVPVH---VIEKVPLP------IPHPVAVQVPNVIRLQIPEPY- 118
             |.|       .|...:.......||   |:..|.:|      :|:||...|...:::.:|:|| 
  Fly    64 IGVG-------VPVAPAVAELPTQVHTNTVVRTVQVPYQVERHVPYPVEKTVTYPVKVPVPQPYP 121

  Fly   119 ---AVHVPVQQEIHVPVYKIVPEITEKKI----------PYT--VEKPYPVEVEKPYPVEVIKQI 168
               .|||||:|.:.|||....|...||.|          |||  |:|||||.||||.|..|.|::
  Fly   122 VEKIVHVPVKQIVKVPVEVPQPYPVEKVIRVPVKIPVDRPYTVHVDKPYPVPVEKPVPYTVEKRV 186

  Fly   169 --KIPV----PKPY----PVPFTIYKHV 186
              |:||    |.||    |||..:..||
  Fly   187 IHKVPVHVERPVPYKVAVPVPVHVESHV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 35/82 (43%)
Vajk2NP_609689.3 Tir_receptor_C 32..>97 CDD:284826 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.