DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and Vajk1

DIOPT Version :9

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_609688.3 Gene:Vajk1 / 34809 FlyBaseID:FBgn0028938 Length:373 Species:Drosophila melanogaster


Alignment Length:223 Identity:62/223 - (27%)
Similarity:88/223 - (39%) Gaps:112/223 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DGHFHHHTPTTYSEISKHVPVH------VIEKVPLPIPHPVAVQVP-----NV-IRLQIPEPYAV 120
            :.:.|||.|        |.|||      ||:|||:|:|....|.||     :| :::::|:||.|
  Fly    63 EDYHHHHVP--------HFPVHEEKTLTVIKKVPVPVPIEKIVHVPVEKHIHVPVKVKVPKPYPV 119

  Fly   121 --HV------------------PVQQEIHVPVY---------KI---VPEITEKKI--------- 144
              |:                  ||::::||||:         |:   .|...|||:         
  Fly   120 IKHIPYEVKEIVKVPYEVPAPYPVEKQVHVPVHVHYDRPVPVKVHVPAPYPVEKKVHVPVKVHVP 184

  Fly   145 -PYTVE--------------KPYPVE--------------------------VEKPYPVEVIKQI 168
             ||.||              ||||||                          |:||.||.|||::
  Fly   185 APYPVEKIVHYNVEKHVHVDKPYPVEKVVHYPVKVPVDKPVPHYIDKPVPHYVDKPVPVPVIKKV 249

  Fly   169 KIPVPKPY----------PVPFTIYKHV 186
            .:||..||          |||:.:..||
  Fly   250 PVPVHVPYDRPVPVHVEKPVPYEVKVHV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 36/132 (27%)
Vajk1NP_609688.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.