DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and Zfp512b

DIOPT Version :9

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_038961080.1 Gene:Zfp512b / 311721 RGDID:1305284 Length:1035 Species:Rattus norvegicus


Alignment Length:217 Identity:56/217 - (25%)
Similarity:73/217 - (33%) Gaps:81/217 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YGDGYGY---GGSGGGGSGSLGSGG--GGDGHFHHHTP-----------------------TTYS 80
            ||..|.|   .|..|.|||....||  |......|.||                       |:.:
  Rat   240 YGLKYHYQRCQGVRGCGSGKRRPGGASGQRPPGPHPTPALPAQGAISDRLAFPCPFCEAAFTSKT 304

  Fly    81 EISKH-------------------------------VPVHVIEKV----PLPIPHPVAVQVPNVI 110
            ::.||                               .|:.|.:.|    |:.:..|:.:..|..:
  Rat   305 QLEKHRIWNHMDHPLPAPKPGPVSRPVTINRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTV 369

  Fly   111 RLQIP--EPYAVHVPVQQEIHVPVYKIVPEITEKKIPYTVEKPY--------PVEVEKPYPVEVI 165
            ...||  :|..|..|:|....|||.|.:| || |.:|.|...|.        ||.:.||.||   
  Rat   370 SRPIPVTKPVTVSRPMQVSRPVPVTKPIP-IT-KPVPLTKHMPVTKLVTVSKPVPLTKPVPV--- 429

  Fly   166 KQIKIPVPKPYPV--PFTIYKH 185
             ...|.|.||.||  |..|.:|
  Rat   430 -SRPIVVSKPVPVSRPIAISRH 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 27/70 (39%)
Zfp512bXP_038961080.1 PHA03247 <265..624 CDD:223021 45/192 (23%)
C2H2 Zn finger 739..760 CDD:275368
C2H2 Zn finger 775..796 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.