DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp1b4

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_445833.2 Gene:Atp1b4 / 84396 RGDID:620994 Length:356 Species:Rattus norvegicus


Alignment Length:331 Identity:64/331 - (19%)
Similarity:119/331 - (35%) Gaps:111/331 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 KEDRRTYYKGCEYHFPGRTEWRRLFFNKIHGKY--------KLRR--PSHWLYTLVFSVLY---- 614
            :|:.|...:| :....|...||:|   :|..:|        .|.|  .|..|..:::...|    
  Rat    63 EEEEREEEEG-QGQSTGNAWWRKL---QIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYASLA 123

  Fly   615 ---ILFVIIFSMAWFDFIKDDASRKVPMIKMAQPFISFTPIGPRTNPKAVSFDPR-NSTEVMEKY 675
               .||:.:..:|...::.....:..|...|.:||           ..:::|:.. :..|..::|
  Rat   124 AVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPF-----------AHSLNFNFNVSEPETWQRY 177

  Fly   676 A-GIMALLEKY---------------------GDYGHNPR--------FGTCTANE--KFGYPSG 708
            . .:...|:.|                     ||...:.:        ...|:..|  .|||.:|
  Rat   178 VISLNGFLQGYNDSLQEEMNIDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTG 242

  Fly   709 EPCVFLKVNRIIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDK-D 772
            :||:.||:|||:||:.|    ..:.||                             ::|:..| |
  Rat   243 QPCILLKMNRIVGFRPE----FGDPVK-----------------------------VSCKVQKGD 274

  Fly   773 KNVL--IEFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCK 835
            :|.:  |.::||.|        ...:.|....||.:..  |..:.:||:...::..|:.|.:.|:
  Rat   275 ENNIRSINYYPESA--------SFDLRYYPYYGKLTHV--NYTSPLVAMHFTDVVKNQEVPVQCQ 329

  Fly   836 MWAQNI 841
            :..:.|
  Rat   330 LKGKGI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 34/142 (24%)
Atp1b4NP_445833.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..77 3/14 (21%)
Na_K-ATPase 90..348 CDD:395224 56/300 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.